PDB entry 1a28

View 1a28 on RCSB PDB site
Description: hormone-bound human progesterone receptor ligand-binding domain
Class: progesterone receptor
Keywords: progesterone receptor, steroid receptor, nuclear receptor, transcription regulation
Deposited on 1998-01-19, released 1998-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PGR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a28a_
  • Chain 'B':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PGR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a28b_
  • Heterogens: STR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a28A (A:)
    gqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslp
    gfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfysl
    cltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaig
    lrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaql
    pkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a28A (A:)
    qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
    lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
    wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
    gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
    agmvkpllfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a28B (B:)
    gqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslp
    gfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfysl
    cltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaig
    lrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaql
    pkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a28B (B:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfh