PDB entry 1a25

View 1a25 on RCSB PDB site
Description: c2 domain from protein kinase c (beta)
Class: calcium-binding protein
Keywords: calcium++/phospholipid binding protein, calcium-binding protein
Deposited on 1998-01-16, released 1998-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase c (beta)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a25a_
  • Chain 'B':
    Compound: protein kinase c (beta)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a25b_
  • Heterogens: CA, PSE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a25A (A:)
    gspgisgggggildsmerrgriyiqahidrevlivvvrdaknlvpmdpnglsdpyvklkl
    ipdpkseskqktktikcslnpewnetfrfqlkesdkdrrlsveiwdwdltsrndfmgsls
    fgiselqkagvdgwfkllsqeegeyfnvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a25A (A:)
    errgriyiqahidrevlivvvrdaknlvpmdpnglsdpyvklklipdpkseskqktktik
    cslnpewnetfrfqlkesdkdrrlsveiwdwdltsrndfmgslsfgiselqkagvdgwfk
    llsqeegeyfnv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a25B (B:)
    gspgisgggggildsmerrgriyiqahidrevlivvvrdaknlvpmdpnglsdpyvklkl
    ipdpkseskqktktikcslnpewnetfrfqlkesdkdrrlsveiwdwdltsrndfmgsls
    fgiselqkagvdgwfkllsqeegeyfnvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a25B (B:)
    errgriyiqahidrevlivvvrdaknlvpmdpnglsdpyvklklipdpkseskqktktik
    cslnpewnetfrfqlkesdkdrrlsveiwdwdltsrndfmgslsfgiselqkagvdgwfk
    llsqeegeyfnv