PDB entry 1a24

View 1a24 on RCSB PDB site
Description: solution nmr structure of reduced dsba from escherichia coli, family of 20 structures
Class: oxidoreductase
Keywords: thiol-disulfide oxidoreductase, introduction of disulfide bonds, protein folding, redox-active center
Deposited on 1998-01-15, released 1998-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dsba
    Species: Escherichia coli [TaxId:562]
    Gene: DSBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a24a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a24A (A:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk