PDB entry 1a23

View 1a23 on RCSB PDB site
Description: solution nmr structure of reduced dsba from escherichia coli, minimized average structure
Class: oxidoreductase
Keywords: thiol-disulfide oxidoreductase, introduction of disulfide bonds, protein folding, redox-active center
Deposited on 1998-01-15, released 1998-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dsba
    Species: Escherichia coli [TaxId:562]
    Gene: DSBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a23a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a23A (A:)
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsekk