PDB entry 1a22

View 1a22 on RCSB PDB site
Description: human growth hormone bound to single receptor
Deposited on 1998-01-15, released 1998-04-29
The last revision prior to the SCOP 1.57 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.187
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a22A (A:)
    fptiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpqtslcfsesipt
    psnreetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleer
    iqtlmgrlegqifkqtyskfdtdallknygllycfrkdmdkvetflrivqcrsvegscgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a22B (B:)
    pkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsagen
    scyfnssftsiwipycikltsnggtvdekcfsvdeivqpdppialnwtllnvsltgihad
    iqvrweaprnadiqkgwmvleyelqykevnetkwkmmdpilttsvpvyslkvdkeyevrv
    rskqrnsgnygefsevlyvtlpqms
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a22B (B:)
    pkftkcrsperetfschwtlgpiqlfytrrntqewtqewkecpdyvsagenscyfnssft
    siwipycikltsnggtvdekcfsvdeivqpdppialnwtllngihadiqvrweaprnadi
    qkgwmvleyelqykevnetkwkmmdpilttsvpvyslkvdkeyevrvrskqrnsgnygef
    sevlyvtlpqms