PDB entry 1a21

View 1a21 on RCSB PDB site
Description: tissue factor (tf) from rabbit
Deposited on 1998-01-14, released 1998-05-27
The last revision prior to the SCOP 1.59 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.191
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a21A (A:)
    tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
    dvgqtymarvlsyparngnttgfpeeppfrnspeftpyldtnlgqptiqsfeqvgtklnv
    tvqdartlvrrngtflslravfgkdlnytlyywrasstgkktattntneflidvdkgeny
    cfsvqavipsrkrkqrspesltect
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a21A (A:)
    tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
    dvgqtymarvlsyparnttgfpeeppfrnspeftpyldtnlgqptiqsfeqvgtklnvtv
    qdartlvtflslravfgkdlnytlyywrkktattntneflidvdkgenycfsvqavipsr
    krkqrspesltect
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a21B (B:)
    tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
    dvgqtymarvlsyparngnttgfpeeppfrnspeftpyldtnlgqptiqsfeqvgtklnv
    tvqdartlvrrngtflslravfgkdlnytlyywrasstgkktattntneflidvdkgeny
    cfsvqavipsrkrkqrspesltect
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a21B (B:)
    tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
    dvgqtymarvlsypanttgfpeeppfrnspeftpyldtnlgqptiqsfeqvgtklnvtvq
    dartlvrrngtflslravfgkdlnytlyywrkktattntneflidvdkgenycfsvqavi
    psrkrkqrspesltect