PDB entry 1a1z

View 1a1z on RCSB PDB site
Description: fadd death effector domain, f25g mutant, nmr minimized average structure
Class: apoptosis
Keywords: apoptosis, death effector domain
Deposited on 1997-12-18, released 1998-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fadd protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13158 (0-82)
      • engineered (24)
    Domains in SCOPe 2.07: d1a1za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a1zA (A:)
    mdpflvllhsvssslssseltelkglclgrvgkrklervqsgldlfsmlleqndlepght
    ellrellaslrrhdllrrvddfelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1zA (A:)
    mdpflvllhsvssslssseltelkglclgrvgkrklervqsgldlfsmlleqndlepght
    ellrellaslrrhdllrrvddfe