PDB entry 1a1x

View 1a1x on RCSB PDB site
Description: crystal structure of mtcp-1 involved in t cell malignancies
Class: proto-oncogene
Keywords: mtcp-1, crystal structure, oncogene involved in t cell malignancies, proto-oncogene
Deposited on 1997-12-18, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hmtcp-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a1xa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1a1xA (A:)
gsagedvgappdhlwvhqegiyrdeyqrtwvavveeetsflrarvqqiqvplgdaarpsh
lltsqlplmwqlypeerymdnnsrlwqiqhhlmvrgvqelllkllpdd

    Sequence, based on observed residues (ATOM records): (download) 
    >1a1xA (A:)
agedvgappdhlwvhqegiyrdeyqrtwvavveeetsflrarvqqiqvplgdaarpshll
tsqlplmwqlypeerymdnnsrlwqiqhhlmvrgvqelllkllpdd