PDB entry 1a1v

View 1a1v on RCSB PDB site
Description: hepatitis c virus ns3 helicase domain complexed with single stranded sdna
Class: hydrolase/DNA
Keywords: hepatitis c virus, RNA helicase, nonstructural proteins, single-stranded DNA, hydrolase/DNA complex
Deposited on 1997-12-17, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ns3 protein)
    Species: Hepatitis C virus [TaxId:11108]
    Gene: NS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27958
      • conflict (26)
      • conflict (82)
      • modified residue (113)
      • conflict (252)
      • modified residue (265)
      • conflict (283)
      • modified residue (333)
      • conflict (391)
      • conflict (443)
      • conflict (449)
    Domains in SCOPe 2.07: d1a1va1, d1a1va2
  • Chain 'B':
    Compound: DNA (5'-d(*up*up*up*up*up*up*up*u)-3')
    Species: synthetic, synthetic
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a1vA (A:)
    mvdfipvenlettmrspvftdnssppavpqsfqvahlhaptgsgkstkvpaayaaqgykv
    lvlnpsvaatlgfgaymskahgvdpnirtgvrtittgspitystygkfladggcsggayd
    iiicdechstdatsilgigtvldqaetagarlvvlatatppgsvtvphpnieevalsttg
    eipfygkaiplevikggrhlifchskkkcdelaaklvalginavayyrgldvsviptsgd
    vvvvatdalmtgftgdfdsvidcntcvtqtvdfsldptftietttlpqdavsrtqrrgrt
    grgkpgiyrfvapgerpsgmfdssvlcecydagcawyeltpaettvrlraymntpglpvc
    qdhlefwegvftglthidahflsqtkqsgenfpylvayqatvcaraqapppswdqmwkcl
    irlkptlhgptpllyrlgavqnevtlthpitkyimtcmsadlevvtgsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1vA (A:)
    ppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgvd
    pnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtvldq
    aetagarlvvlatatppgsvtvphpnieevalsttgeipfygkaiplevikggrhlifch
    skkkcdelaaklvalginavayyrgldvsviptsgdvvvvatdalftgdfdsvidcntcv
    tqtvdfsldptftietttlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlc
    ecydagcawyeltpaettvrlraymntpglpvcqdhlefwegvftglthidahflsqtkq
    sgenfpylvayqatvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlt
    hpitkyimtcms
    

  • Chain 'B':
    No sequence available.