PDB entry 1a1t

View 1a1t on RCSB PDB site
Description: structure of the hiv-1 nucleocapsid protein bound to the sl3 psi-rna recognition element, nmr, 25 structures
Deposited on 1997-12-15, released 1998-06-17
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a1ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a1tA (A:)
    mqkgnfrnqrktvkcfncgkeghiakncraprkkgcwkcgkeghqmkdcterqan