PDB entry 1a1s

View 1a1s on RCSB PDB site
Description: ornithine carbamoyltransferase from pyrococcus furiosus
Class: transcarbamylase
Keywords: transcarbamylase
Deposited on 1997-12-15, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ornithine carbamoyltransferase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51742 (0-End)
      • conflict (205-206)
    Domains in SCOPe 2.07: d1a1sa1, d1a1sa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a1sA (A:)
    vvslagrdllclqdytaeeiwtiletakmfkiwqkigkphrllegktlamifqkpstrtr
    vsfevamahlgghalylnaqdlqlrrgetiadtarvlsryvdaimarvydhkdvedlaky
    atvpvinglsdfshpcqaladymtiwekkgtikgvkvvyvgdgnnvahslmiagtklgad
    vvvatpegyepdekvikwaeqnaaesggsfellhdpvkavkdadviytdvwasmgqeaea
    eerrkifrpfqvnkdlvkhakpdymfmhclpahrgeevtddvidspnsvvwdqaenrlha
    qkavlalvmggikf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1sA (A:)
    vvslagrdllclqdytaeeiwtiletakmfkiwqkigkphrllegktlamifqkpstrtr
    vsfevamahlgghalylnaqdlqlrrgetiadtarvlsryvdaimarvydhkdvedlaky
    atvpvinglsdfshpcqaladymtiwekkgtikgvkvvyvgdgnnvahslmiagtklgad
    vvvatpegyepdekvikwaeqnaaesggsfellhdpvkavkdadviytdvwasmgqeaea
    eerrkifrpfqvnkdlvkhakpdymfmhclpahrgeevtddvidspnsvvwdqaenrlha
    qkavlalvmggik