PDB entry 1a1j

View 1a1j on RCSB PDB site
Description: radr (zif268 variant) zinc finger-DNA complex (gcgt site)
Class: transcription/DNA
Keywords: zinc finger-DNA complex, zinc finger, DNA-binding protein, transcription/DNA complex
Deposited on 1997-12-10, released 1998-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (radr zif268 zinc finger peptide)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08046
      • variant (19-20)
    Domains in SCOPe 2.08: d1a1ja1, d1a1ja2, d1a1ja3
  • Chain 'B':
    Compound: DNA (5'-d(*ap*gp*cp*gp*tp*gp*gp*gp*cp*gp*t)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*cp*gp*cp*cp*cp*ap*cp*gp*c)-3')
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1a1jA (A:)
merpyacpvescdrrfsrsadltrhirihtgqkpfqcricmrnfsrsdhltthirthtge
kpfacdicgrkfarsderkrhtkihlrqkd

    Sequence, based on observed residues (ATOM records): (download) 
    >1a1jA (A:)
rpyacpvescdrrfsrsadltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
facdicgrkfarsderkrhtkihl

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.