PDB entry 1a1i

View 1a1i on RCSB PDB site
Description: radr (zif268 variant) zinc finger-DNA complex (gcac site)
Class: transcription/DNA
Keywords: zinc finger-DNA complex, zinc finger, DNA-binding protein
Deposited on 1997-12-10, released 1998-06-10
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: radr zif268 zinc finger peptide
  Species: MUS MUSCULUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08046
    • variant (19-20)
  Domains in SCOP 1.55: d1a1ia1, d1a1ia2, d1a1ia3
• Chain 'B':
  Compound: DNA (5'-d(*ap*gp*cp*gp*tp*gp*gp*gp*cp*ap*c)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*tp*gp*tp*gp*cp*cp*cp*ap*cp*gp*c)-3')
  
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a1iA (A:)
  rpyacpvescdrrfsrsadltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
  facdicgrkfarsderkrhtkihlr
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.