PDB entry 1a1g
View 1a1g on RCSB PDB site
Description: dsnr (zif268 variant) zinc finger-DNA complex (gcgt site)
Class: transcription/DNA
Keywords: complex (zinc finger/DNA), zinc finger, DNA-binding protein, transcription/DNA complex
Deposited on
1997-12-10, released
1998-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: dsnr zinc finger peptide
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Uniprot P08046
- variant (17)
- variant (19-20)
Domains in SCOPe 2.08: d1a1ga1, d1a1ga2, d1a1ga3 - Chain 'B':
Compound: DNA (5'-d(*ap*gp*cp*gp*tp*gp*gp*gp*cp*gp*t)-3')
- Chain 'C':
Compound: DNA (5'-d(*tp*ap*cp*gp*cp*cp*cp*ap*cp*gp*c)-3')
- Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1a1gA (A:)
merpyacpvescdrrfsdssnltrhirihtgqkpfqcricmrnfsrsdhltthirthtge
kpfacdicgrkfarsderkrhtkihlrqkd
Sequence, based on observed residues (ATOM records): (download)
>1a1gA (A:)
rpyacpvescdrrfsdssnltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
facdicgrkfarsderkrhtkihl
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.