PDB entry 1a1g

View 1a1g on RCSB PDB site
Description: dsnr (zif268 variant) zinc finger-DNA complex (gcgt site)
Class: transcription/DNA
Keywords: complex (zinc finger/DNA), zinc finger, DNA-binding protein, transcription/DNA complex
Deposited on 1997-12-10, released 1998-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dsnr zinc finger peptide
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08046
      • variant (17)
      • variant (19-20)
    Domains in SCOPe 2.08: d1a1ga1, d1a1ga2, d1a1ga3
  • Chain 'B':
    Compound: DNA (5'-d(*ap*gp*cp*gp*tp*gp*gp*gp*cp*gp*t)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*cp*gp*cp*cp*cp*ap*cp*gp*c)-3')
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a1gA (A:)
    merpyacpvescdrrfsdssnltrhirihtgqkpfqcricmrnfsrsdhltthirthtge
    kpfacdicgrkfarsderkrhtkihlrqkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1gA (A:)
    rpyacpvescdrrfsdssnltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
    facdicgrkfarsderkrhtkihl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.