PDB entry 1a1d

View 1a1d on RCSB PDB site
Description: yeast RNA polymerase subunit rpb8, nmr, minimized average structure, alpha carbons only
Class: nucleotidyltransferase
Keywords: rpb8, RNA polymerase, ob fold, eukaryotic, yeast, nucleotidyltransferase
Deposited on 1997-12-10, released 1999-03-02
The last revision prior to the SCOP 1.75 freeze date was dated 1999-04-20, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1a1da_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a1dA (A:)
    msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia
    sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg
    llmrlegnyrnlnnlkqenayllirr