PDB entry 1a1b

View 1a1b on RCSB PDB site
Description: c-src (sh2 domain) complexed with ace-phosphotyr-glu-(n,n-dipentyl amine)
Deposited on 1997-12-10, released 1998-04-08
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a1ba_
  • Chain 'B':
    Domains in SCOP 1.55: d1a1bb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a1bA (A:)
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a1bB (B:)
iqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhy
kirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp