PDB entry 1a1b

View 1a1b on RCSB PDB site
Description: c-src (sh2 domain) complexed with ace-phosphotyr-glu-(n,n-dipentyl amine)
Class: complex (transferase/peptide)
Keywords: complex (transferase/peptide)
Deposited on 1997-12-10, released 1998-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-src tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a1ba_
  • Chain 'B':
    Compound: c-src tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a1bb_
  • Chain 'C':
    Compound: ace-phosphotyr-glu-(n,n-dipentyl amine)
    Database cross-references and differences (RAF-indexed):
    • PDB 1A1B (Start-2)
  • Chain 'D':
    Compound: ace-phosphotyr-glu-(n,n-dipentyl amine)
    Database cross-references and differences (RAF-indexed):
    • PDB 1A1B (Start-2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a1bA (A:)
    mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnv
    khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1bA (A:)
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a1bB (B:)
    mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnv
    khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1bB (B:)
    iqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhy
    kirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.