PDB entry 1a1a

View 1a1a on RCSB PDB site
Description: c-src (sh2 domain with c188a mutation) complexed with ace-formyl phosphotyr-glu-(n,n-dipentyl amine)
Deposited on 1997-12-10, released 1998-04-08
The last revision prior to the SCOP 1.57 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1a1aa_
  • Chain 'B':
    Domains in SCOP 1.57: d1a1ab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a1aA (A:)
    dsiqaeewyfgkitrreserlllnaenprgtflvresettkgayslsvsdfdnakglnvk
    hykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a1aB (B:)
    aeewyfgkitrreserlllnaenprgtflvresettkgayslsvsdfdnakglnvkhyki
    rkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp