PDB entry 1a1a

View 1a1a on RCSB PDB site
Description: c-src (sh2 domain with c188a mutation) complexed with ace-formyl phosphotyr-glu-(n,n-dipentyl amine)
Class: complex (transferase/peptide)
Keywords: COMPLEX (TRANSFERASE-PEPTIDE), COMPLEX (TRANSFERASE-PEPTIDE) complex
Deposited on 1997-12-10, released 1998-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-src tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (1-106)
      • engineered (45)
    Domains in SCOPe 2.07: d1a1aa_
  • Chain 'B':
    Compound: c-src tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (Start-106)
      • engineered (45)
    Domains in SCOPe 2.07: d1a1ab_
  • Chain 'C':
    Compound: ace-formyl phosphotyr-glu-(n,n-dipentyl amine)
    Database cross-references and differences (RAF-indexed):
    • PDB 1A1A (Start-2)
  • Chain 'D':
    Compound: ace-formyl phosphotyr-glu-(n,n-dipentyl amine)
    Database cross-references and differences (RAF-indexed):
    • PDB 1A1A (Start-2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a1aA (A:)
    mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayslsvsdfdnakglnv
    khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1aA (A:)
    dsiqaeewyfgkitrreserlllnaenprgtflvresettkgayslsvsdfdnakglnvk
    hykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a1aB (B:)
    mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayslsvsdfdnakglnv
    khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1aB (B:)
    aeewyfgkitrreserlllnaenprgtflvresettkgayslsvsdfdnakglnvkhyki
    rkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.