PDB entry 1a19

View 1a19 on RCSB PDB site
Description: barstar (free), c82a mutant
Deposited on 1997-12-25, released 1998-04-08
The last revision prior to the SCOP 1.57 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.203
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1a19a_
  • Chain 'B':
    Domains in SCOP 1.57: d1a19b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a19A (A:)
    kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
    qltengaesvlqvfreakaegaditiils
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a19B (B:)
    kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
    qltengaesvlqvfreakaegaditiils