PDB entry 1a19

View 1a19 on RCSB PDB site
Description: barstar (free), c82a mutant
Class: ribonuclease inhibitor
Keywords: barstar, c82a, dimer, uncomplexed, ribonuclease inhibitor
Deposited on 1997-12-25, released 1998-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.203
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barstar
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11540 (1-89)
      • engineered (82)
    Domains in SCOPe 2.07: d1a19a_
  • Chain 'B':
    Compound: barstar
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11540 (1-89)
      • engineered (82)
    Domains in SCOPe 2.07: d1a19b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a19A (A:)
    mkkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqs
    kqltengaesvlqvfreakaegaditiils
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a19A (A:)
    kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
    qltengaesvlqvfreakaegaditiils
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a19B (B:)
    mkkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqs
    kqltengaesvlqvfreakaegaditiils
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a19B (B:)
    kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
    qltengaesvlqvfreakaegaditiils