PDB entry 1a16

View 1a16 on RCSB PDB site
Description: aminopeptidase p from e. coli with the inhibitor pro-leu
Class: hydrolase/hydrolase inhibitor
Keywords: proline peptidase-dipeptide inhibitor complex, hydrolase-hydrolase inhibitor complex
Deposited on 1997-12-22, released 1999-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminopeptidase p
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a16a1, d1a16a2
  • Heterogens: PRO, LEU, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a16A (A:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaarkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a16A (A:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsleklrkgsrqnltapatmidwrpvvhemrlfkspeei
    avlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengci
    lhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivlesletsl
    rlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldvh
    dvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgnenlta
    svvkkpeeiealmvaarkq