PDB entry 1a15

View 1a15 on RCSB PDB site
Description: sdf-1alpha
Class: chemokine
Keywords: chemokine, human stromal cell-derived factor-1alpha
Deposited on 1997-12-22, released 1998-08-12
The last revision prior to the SCOP 1.75 freeze date was dated 1998-08-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.233
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: stromal derived factor-1alpha
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48061 (0-66)
    • engineered (32)
  Domains in SCOP 1.75: d1a15a_
• Chain 'B':
  Compound: stromal derived factor-1alpha
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48061
    • engineered (32)
  Domains in SCOP 1.75: d1a15b_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a15A (A:)
  kpvslsyrcpcrffeshvaranvkhlkilntpacalqivarlknnnrqvcidpklkwiqe
  ylekaln
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1a15B (B:)
  kpvslsyrcpcrffeshvaranvkhlkilntpacalqivarlknnnrqvcidpklkwiqe
  ylekaln
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1a15B (B:)
  rcpcrffeshvaranvkhlkilntpacalqivarlknnnrqvcidpklkwiqeylek