PDB entry 1a15

View 1a15 on RCSB PDB site
Description: sdf-1alpha
Deposited on 1997-12-22, released 1998-08-12
The last revision prior to the SCOP 1.57 freeze date was dated 1998-08-12, with a file datestamp of 1998-08-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.233
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1a15a_
  • Chain 'B':
    Domains in SCOP 1.57: d1a15b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a15A (A:)
    kpvslsyrcpcrffeshvaranvkhlkilntpacalqivarlknnnrqvcidpklkwiqe
    ylekaln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a15B (B:)
    rcpcrffeshvaranvkhlkilntpacalqivarlknnnrqvcidpklkwiqeylek