PDB entry 1a14

View 1a14 on RCSB PDB site
Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 5 residue linker and influenza virus neuraminidase
Class: complex (antibody/antigen)
Keywords: COMPLEX (ANTIBODY-ANTIGEN), SINGLE-CHAIN ANTIBODY, GLYCOSYLATED PROTEIN, COMPLEX (ANTIBODY-ANTIGEN) complex
Deposited on 1997-12-21, released 1998-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: nc10 fv (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA19165 (0-119)
    Domains in SCOPe 2.07: d1a14h1, d1a14h2
  • Chain 'L':
    Compound: nc10 fv (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA19165 (0-101)
    Domains in SCOPe 2.07: d1a14l_
  • Chain 'N':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a14n_
  • Heterogens: MAN, NAG, NDG, CA

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a14H (H:)
    qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
    nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a14L (L:)
    dieltqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
    rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtaa
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a14N (N:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl