PDB entry 1a12

View 1a12 on RCSB PDB site
Description: regulator of chromosome condensation (rcc1) of human
Class: guanine nucleotide exchange factor
Keywords: guanine nucleotide exchange factor, gef, ran, ras-like nuclear GTP binding protein
Deposited on 1997-12-19, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulator of chromosome condensation 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a12a_
  • Chain 'B':
    Compound: regulator of chromosome condensation 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a12b_
  • Chain 'C':
    Compound: regulator of chromosome condensation 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a12c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a12A (A:)
    rrsppadaipkskkvkvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsiped
    vvqaeaggmhtvclsksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagd
    shtaaltddgrvflwgsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmlt
    adgdlytlgcgeqgqlgrvpelfanrggrqglerllvpkcvmlksrgsrghvrfqdafcg
    ayftfaisheghvygfglsnyhqlgtpgtescfipqnltsfknstkswvgfsggqhhtvc
    mdsegkayslgraeygrlglgegaeeksiptlisrlpavssvacgasvgyavtkdgrvfa
    wgmgtnyqlgtgqdedawspvemmgkqlenrvvlsvssggqhtvllvkdkeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a12A (A:)
    kkvkvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtv
    clsksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrv
    flwgsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcge
    qgqlgrvpelfanrggrqglerllvpkcvmlksrgsrghvrfqdafcgayftfaishegh
    vygfglsnyhqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgr
    aeygrlglgegaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtg
    qdedawspvemmgkqlenrvvlsvssggqhtvllvkdkeqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a12B (B:)
    rrsppadaipkskkvkvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsiped
    vvqaeaggmhtvclsksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagd
    shtaaltddgrvflwgsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmlt
    adgdlytlgcgeqgqlgrvpelfanrggrqglerllvpkcvmlksrgsrghvrfqdafcg
    ayftfaisheghvygfglsnyhqlgtpgtescfipqnltsfknstkswvgfsggqhhtvc
    mdsegkayslgraeygrlglgegaeeksiptlisrlpavssvacgasvgyavtkdgrvfa
    wgmgtnyqlgtgqdedawspvemmgkqlenrvvlsvssggqhtvllvkdkeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a12B (B:)
    kkvkvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtv
    clsksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrv
    flwgsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcge
    qgqlgrvpelfanrggrqglerllvpkcvmlksrgsrghvrfqdafcgayftfaishegh
    vygfglsnyhqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgr
    aeygrlglgegaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtg
    qdedawspvemmgkqlenrvvlsvssggqhtvllvkdkeqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a12C (C:)
    rrsppadaipkskkvkvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsiped
    vvqaeaggmhtvclsksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagd
    shtaaltddgrvflwgsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmlt
    adgdlytlgcgeqgqlgrvpelfanrggrqglerllvpkcvmlksrgsrghvrfqdafcg
    ayftfaisheghvygfglsnyhqlgtpgtescfipqnltsfknstkswvgfsggqhhtvc
    mdsegkayslgraeygrlglgegaeeksiptlisrlpavssvacgasvgyavtkdgrvfa
    wgmgtnyqlgtgqdedawspvemmgkqlenrvvlsvssggqhtvllvkdkeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a12C (C:)
    kkvkvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtv
    clsksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrv
    flwgsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcge
    qgqlgrvpelfanrggrqglerllvpkcvmlksrgsrghvrfqdafcgayftfaishegh
    vygfglsnyhqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgr
    aeygrlglgegaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtg
    qdedawspvemmgkqlenrvvlsvssggqhtvllvkdkeqs