PDB entry 1a10

View 1a10 on RCSB PDB site
Description: alcalase (subtilisin carlsberg variant) in complex with chymotrypsin inhibitor ci-2a(m59p)
Class: complex (serine protease/inhibitor)
Keywords: proteinase, subtilisin, complex (serine protease/inhibitor)
Deposited on 1997-12-18, released 1998-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-06-12, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.118
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: alcalase
    Species: BACILLUS LICHENIFORMIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00780 (0-273)
      • conflict (101)
      • conflict (127)
      • conflict (210)
    Domains in SCOPe 2.07: d1a10e_
  • Chain 'I':
    Compound: subtilisin-chymotrypsin inhibitor-2
    Species: Hordeum vulgare
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01053 (0-62)
      • engineered (38)
      • conflict (57)
    Domains in SCOPe 2.07: d1a10i_
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a10E (E:)
    aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
    nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
    inmslggasgstamkqavdnayargvvvvaaagnsgssgntntigypakydsviavgavd
    snsnrasfssvgaelevmapgagvystyptntyatlngtsmasphvagaaalilskhpnl
    sasqvrnrlsstatylgssfyygkglinveaaaq
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a10I (I:)
    ktewpelvgksveeakkvilqdkpeaqiivlpvgtivtpeyridrvrlfvdkldniaevp
    rvg