PDB entry 1a0t

View 1a0t on RCSB PDB site
Description: sucrose-specific porin, with bound sucrose molecules
Class: outer membrane protein
Keywords: outer membrane protein, porin
Deposited on 1997-12-08, released 1998-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: sucrose-specific porin
    Species: Salmonella typhimurium [TaxId:602]
    Gene: SCRY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a0tp_
  • Chain 'Q':
    Compound: sucrose-specific porin
    Species: Salmonella typhimurium [TaxId:602]
    Gene: SCRY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a0tq_
  • Chain 'R':
    Compound: sucrose-specific porin
    Species: Salmonella typhimurium [TaxId:602]
    Gene: SCRY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a0tr_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0tP (P:)
    sgfefhgyarsgvimndsgastksgayitpagetggaigrlgnqadtyvemnlehkqtld
    ngattrfkvmvadgqtsyndwtastsdlnvrqafvelgnlptfagpfkgstlwagkrfdr
    dnfdihwidsdvvflagtgggiydvkwndglrsnfslygrnfgdiddssnsvqnyiltmn
    hfagplqmmvsglrakdnderkdsngnlakgdaantgvhallglhndsfyglrdgsskta
    llyghglgaevkgigsdgalrpgadtwriasygttplsenwsvapamlaqrskdryadgd
    syqwatfnlrliqainqnfalayegsyqymdlkpegyndrqavngsfykltfaptfkvgs
    igdffsrpeirfytswmdwskklnnyasddalgsdgfnsggewsfgvqmetwf
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0tQ (Q:)
    sgfefhgyarsgvimndsgastksgayitpagetggaigrlgnqadtyvemnlehkqtld
    ngattrfkvmvadgqtsyndwtastsdlnvrqafvelgnlptfagpfkgstlwagkrfdr
    dnfdihwidsdvvflagtgggiydvkwndglrsnfslygrnfgdiddssnsvqnyiltmn
    hfagplqmmvsglrakdnderkdsngnlakgdaantgvhallglhndsfyglrdgsskta
    llyghglgaevkgigsdgalrpgadtwriasygttplsenwsvapamlaqrskdryadgd
    syqwatfnlrliqainqnfalayegsyqymdlkpegyndrqavngsfykltfaptfkvgs
    igdffsrpeirfytswmdwskklnnyasddalgsdgfnsggewsfgvqmetwf
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0tR (R:)
    sgfefhgyarsgvimndsgastksgayitpagetggaigrlgnqadtyvemnlehkqtld
    ngattrfkvmvadgqtsyndwtastsdlnvrqafvelgnlptfagpfkgstlwagkrfdr
    dnfdihwidsdvvflagtgggiydvkwndglrsnfslygrnfgdiddssnsvqnyiltmn
    hfagplqmmvsglrakdnderkdsngnlakgdaantgvhallglhndsfyglrdgsskta
    llyghglgaevkgigsdgalrpgadtwriasygttplsenwsvapamlaqrskdryadgd
    syqwatfnlrliqainqnfalayegsyqymdlkpegyndrqavngsfykltfaptfkvgs
    igdffsrpeirfytswmdwskklnnyasddalgsdgfnsggewsfgvqmetwf