PDB entry 1a0q

View 1a0q on RCSB PDB site
Description: 29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate
Deposited on 1997-12-05, released 1999-03-02
The last revision prior to the SCOP 1.69 freeze date was dated 1999-05-04, with a file datestamp of 1999-05-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1a0qH (H:)
    evqlqesdaelvkpgasvkisckasgytftdhvihwvkqkpeqglewigyispgngdiky
    nekfkgkatltadkssstaymqlnsltsedsavylckrgyygrsnvdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0qH (H:)
    vqlqesdaelvkpgasvkisckasgytftdhvihwvkqkpeqglewigyispgngdikyn
    ekfkgkatltadkssstaymqlnsltsedsavylckrgyyvdywgqgttltvssakttpp
    svyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpss
    twpsetvtcnvahpasstkvdkkie
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1a0qL (L:)
    dieltqspsslsaslggkvtitckasqdikkyigwyqhkpgkqprllihytstllpgips
    rfrgsgsgrdysfsisnlepediatyyclqyynlrtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfyskdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0qL (L:)
    ieltqspsslsaslggkvtitckasqdikkyigwyqhkpgkqprllihytstllpgipsr
    frgsgsgrdysfsisnlepediatyyclqyynlrtfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfyskdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrne