PDB entry 1a0j

View 1a0j on RCSB PDB site
Description: crystal structure of a non-psychrophilic trypsin from a cold-adapted fish species.
Class: serine protease
Keywords: serine proteinase, trypsin, hydrolase, serine protease
Deposited on 1997-12-01, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.173
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Salmo salar [TaxId:8030]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0ja_
  • Chain 'B':
    Compound: Trypsin
    Species: Salmo salar [TaxId:8030]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0jb_
  • Chain 'C':
    Compound: Trypsin
    Species: Salmo salar [TaxId:8030]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0jc_
  • Chain 'D':
    Compound: Trypsin
    Species: Salmo salar [TaxId:8030]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0jd_
  • Heterogens: CA, SO4, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0jA (A:)
    ivggyecrknsasyqaslqsgyhfcggslisstwvvsaahcyksriqvrlgehniavneg
    teqfidsvkvimhpsynsrnldndimliklskpaslnsyvstvalpsscassgtrclvsg
    wgnlsgsssnypdtlrcldlpilsssscnsaypgqitsnmfcagfmeggkdscqgdsggp
    vvcngqlqgvvswgygcaqrnkpgvytkvcnyrswisstmssn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0jB (B:)
    ivggyecrknsasyqaslqsgyhfcggslisstwvvsaahcyksriqvrlgehniavneg
    teqfidsvkvimhpsynsrnldndimliklskpaslnsyvstvalpsscassgtrclvsg
    wgnlsgsssnypdtlrcldlpilsssscnsaypgqitsnmfcagfmeggkdscqgdsggp
    vvcngqlqgvvswgygcaqrnkpgvytkvcnyrswisstmssn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0jC (C:)
    ivggyecrknsasyqaslqsgyhfcggslisstwvvsaahcyksriqvrlgehniavneg
    teqfidsvkvimhpsynsrnldndimliklskpaslnsyvstvalpsscassgtrclvsg
    wgnlsgsssnypdtlrcldlpilsssscnsaypgqitsnmfcagfmeggkdscqgdsggp
    vvcngqlqgvvswgygcaqrnkpgvytkvcnyrswisstmssn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0jD (D:)
    ivggyecrknsasyqaslqsgyhfcggslisstwvvsaahcyksriqvrlgehniavneg
    teqfidsvkvimhpsynsrnldndimliklskpaslnsyvstvalpsscassgtrclvsg
    wgnlsgsssnypdtlrcldlpilsssscnsaypgqitsnmfcagfmeggkdscqgdsggp
    vvcngqlqgvvswgygcaqrnkpgvytkvcnyrswisstmssn