PDB entry 1a0i

View 1a0i on RCSB PDB site
Description: ATP-dependent DNA ligase from bacteriophage T7 complex with ATP
Class: ligase
Keywords: ligase, DNA replication
Deposited on 1997-12-01, released 1998-03-25
The last revision prior to the SCOP 1.75 freeze date was dated 1998-03-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.222
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA ligase
    Species: Bacteriophage T7
    Gene: LIG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1a0ia1, d1a0ia2
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a0iA (A:)
    vniktnpfkavsfvesaikkaldnagyliaeikydgvrgnicvdntansywlsrvsktip
    alehlngfdvrwkrllnddrcfykdgfmldgelmvkgvdfntgsgllrtkwtdtknqefh
    eelfvepirkkdkvpfklhtghlhiklyailplhivesgedcdvmtllmqehvknmlpll
    qeyfpeiewqaaesyevydmvelqqlyeqkraegheglivkdpmciykrgkksgwwkmkp
    eneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatls
    qwgffspygigdndactinpydgwacqisymeetpdgslrhpsfvmfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0iA (A:)
    vniktnpfkavsfvesaikkaldnagyliaeikydgvrgnicvdntansywlsrvsktip
    alehlngfdvrwkrllnddrcfykdgfmldgelmvkgvdfntgsgllrtkwtdtknqefh
    rkkdkvpfklhtghlhiklyailplhivesgedcdvmtllmqehvknmlpllqeyfpeie
    wqaaesyevydmvelqqlyeqkraegheglivkdpmciykrgkksgwwkmkpeneadgii
    qglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatlsqwgffdac
    tinpydgwacqisymeetpdgslrhpsfvmfr