PDB entry 1a0g

View 1a0g on RCSB PDB site
Description: l201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate
Class: transferase
Keywords: transferase, aminotransferase, pyridoxal-5'-phosphate, d-amino acid, d-alanine, alpha-ketoglutamic acid
Deposited on 1997-11-30, released 1998-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-amino acid aminotransferase
    Species: Bacillus sp. [TaxId:72579]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19938 (0-End)
      • engineered (200)
    Domains in SCOPe 2.07: d1a0ga_
  • Chain 'B':
    Compound: d-amino acid aminotransferase
    Species: Bacillus sp. [TaxId:72579]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19938 (0-281)
      • engineered (200)
    Domains in SCOPe 2.07: d1a0gb_
  • Heterogens: PMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a0gA (A:)
    gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
    tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
    plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
    snvfgikdgilythpannmiakgitrdvviacaneinmpvkeipftthealkmdelfvts
    ttseitpvieidgklirdgkvgewtrklqkqfetkipkplhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0gA (A:)
    gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
    tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
    plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
    snvfgikdgilythpannmiakgitrdvviacaneinmpvkeipftthealkmdelfvts
    ttseitpvieidgklirdgkvgewtrklqkqfetkipkpl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0gB (B:)
    gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
    tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
    plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
    snvfgikdgilythpannmiakgitrdvviacaneinmpvkeipftthealkmdelfvts
    ttseitpvieidgklirdgkvgewtrklqkqfetkipkplhi