PDB entry 1a0e

View 1a0e on RCSB PDB site
Description: xylose isomerase from thermotoga neapolitana
Class: ketolisomerase
Keywords: ketolisomerase, xylose metabolism, glucose-fructose interconversion, hydride transfer, alpha-beta barrel, metalloenzyme, thermophile
Deposited on 1997-11-28, released 1998-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.18
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Thermotoga neapolitana [TaxId:2337]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0ea_
  • Chain 'D':
    Compound: xylose isomerase
    Species: Thermotoga neapolitana [TaxId:2337]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0ed_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0eA (A:)
    aeffpeipkvqfegkestnplafkfydpeeiidgkplkdhlkfsvafwhtfvnegrdpfg
    dptadrpwnrytdpmdkafarvdalfefceklnieyfcfhdrdiapegktlretnkildk
    vverikermkdsnvkllwgtanlfshprymhgaattcsadvfayaaaqvkkaleitkelg
    gegyvfwggregyetllntdlgfelenlarflrmavdyakrigftgqfliepkpkeptkh
    qydfdvatayaflkshgldeyfkfnieanhatlaghtfqhelrmarilgklgsidanqgd
    lllgwdtdqfptnvydttlamyevikaggftkgglnfdakvrrasykvedlfighiagmd
    tfalgfkvayklvkdgvldkfieekyrsfregigrdivegkvdfekleeyiidketielp
    sgkqeyleslinsyivktilelr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0eD (D:)
    aeffpeipkvqfegkestnplafkfydpeeiidgkplkdhlkfsvafwhtfvnegrdpfg
    dptadrpwnrytdpmdkafarvdalfefceklnieyfcfhdrdiapegktlretnkildk
    vverikermkdsnvkllwgtanlfshprymhgaattcsadvfayaaaqvkkaleitkelg
    gegyvfwggregyetllntdlgfelenlarflrmavdyakrigftgqfliepkpkeptkh
    qydfdvatayaflkshgldeyfkfnieanhatlaghtfqhelrmarilgklgsidanqgd
    lllgwdtdqfptnvydttlamyevikaggftkgglnfdakvrrasykvedlfighiagmd
    tfalgfkvayklvkdgvldkfieekyrsfregigrdivegkvdfekleeyiidketielp
    sgkqeyleslinsyivktilelr