PDB entry 1a0c

View 1a0c on RCSB PDB site
Description: xylose isomerase from thermoanaerobacterium thermosulfurigenes
Class: ketolisomerase
Keywords: ketolisomerase, xylose metabolism, glucose-fructose interconversion, hydride transfer, alpha-beta barrel, metalloenzyme, thermophile
Deposited on 1997-11-28, released 1998-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.168
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Thermoanaerobacterium thermosulfurigenes [TaxId:33950]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0ca_
  • Chain 'B':
    Compound: xylose isomerase
    Species: Thermoanaerobacterium thermosulfurigenes [TaxId:33950]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0cb_
  • Chain 'C':
    Compound: xylose isomerase
    Species: Thermoanaerobacterium thermosulfurigenes [TaxId:33950]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0cc_
  • Chain 'D':
    Compound: xylose isomerase
    Species: Thermoanaerobacterium thermosulfurigenes [TaxId:33950]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0cd_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a0cA (A:)
    nkyfenvskikyegpksnnpysfkfynpeevidgktmeehlrfsiaywhtftadgtdqfg
    katmqrpwnhytdpmdiakarveaafeffdkinapyfcfhdrdiapegdtlretnknldt
    ivamikdylktsktkvlwgtanlfsnprfvhgastscnadvfaysaaqvkkaleitkelg
    genyvfwggregyetllntdmefeldnfarflhmavdyakeigfegqfliepkpkeptkh
    qydfdvanvlaflrkydldkyfkvnieanhatlafhdfqhelryaringvlgsidantgd
    mllgwdtdqfptdirmttlamyevikmggfdkgglnfdakvrrasfepedlflghiagmd
    afakgfkvayklvkdrvfdkfieeryasykdgigadivsgkadfrslekyalersqivnk
    sgrqellesilnqylfae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0cA (A:)
    nkyfenvskikyegpksnnpysfkfynpeevidgktmeehlrfsiaywhtftadgtdqfg
    katmqrpwnhytdpmdiakarveaafeffdkinapyfcfhdrdiapegdtlretnknldt
    ivamikdylktsktkvlwgtanlfsnprfvhgastscnadvfaysaaqvkkaleitkelg
    genyvfwggregyetllntdmefeldnfarflhmavdyakeigfegqfliepkpkeptkh
    qydfdvanvlaflrkydldkyfkvnieanhatlafhdfqhelryaringvlgsidantgd
    mllgwdtdqfptdirmttlamyevikmggfdkgglnfdakvrrasfepedlflghiagmd
    afakgfkvayklvkdrvfdkfieeryasykdgigadivsgkadfrslekyalersqivnk
    sgrqellesilnqylfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a0cB (B:)
    nkyfenvskikyegpksnnpysfkfynpeevidgktmeehlrfsiaywhtftadgtdqfg
    katmqrpwnhytdpmdiakarveaafeffdkinapyfcfhdrdiapegdtlretnknldt
    ivamikdylktsktkvlwgtanlfsnprfvhgastscnadvfaysaaqvkkaleitkelg
    genyvfwggregyetllntdmefeldnfarflhmavdyakeigfegqfliepkpkeptkh
    qydfdvanvlaflrkydldkyfkvnieanhatlafhdfqhelryaringvlgsidantgd
    mllgwdtdqfptdirmttlamyevikmggfdkgglnfdakvrrasfepedlflghiagmd
    afakgfkvayklvkdrvfdkfieeryasykdgigadivsgkadfrslekyalersqivnk
    sgrqellesilnqylfae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0cB (B:)
    nkyfenvskikyegpksnnpysfkfynpeevidgktmeehlrfsiaywhtftadgtdqfg
    katmqrpwnhytdpmdiakarveaafeffdkinapyfcfhdrdiapegdtlretnknldt
    ivamikdylktsktkvlwgtanlfsnprfvhgastscnadvfaysaaqvkkaleitkelg
    genyvfwggregyetllntdmefeldnfarflhmavdyakeigfegqfliepkpkeptkh
    qydfdvanvlaflrkydldkyfkvnieanhatlafhdfqhelryaringvlgsidantgd
    mllgwdtdqfptdirmttlamyevikmggfdkgglnfdakvrrasfepedlflghiagmd
    afakgfkvayklvkdrvfdkfieeryasykdgigadivsgkadfrslekyalersqivnk
    sgrqellesilnqylfa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a0cC (C:)
    nkyfenvskikyegpksnnpysfkfynpeevidgktmeehlrfsiaywhtftadgtdqfg
    katmqrpwnhytdpmdiakarveaafeffdkinapyfcfhdrdiapegdtlretnknldt
    ivamikdylktsktkvlwgtanlfsnprfvhgastscnadvfaysaaqvkkaleitkelg
    genyvfwggregyetllntdmefeldnfarflhmavdyakeigfegqfliepkpkeptkh
    qydfdvanvlaflrkydldkyfkvnieanhatlafhdfqhelryaringvlgsidantgd
    mllgwdtdqfptdirmttlamyevikmggfdkgglnfdakvrrasfepedlflghiagmd
    afakgfkvayklvkdrvfdkfieeryasykdgigadivsgkadfrslekyalersqivnk
    sgrqellesilnqylfae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0cC (C:)
    nkyfenvskikyegpksnnpysfkfynpeevidgktmeehlrfsiaywhtftadgtdqfg
    katmqrpwnhytdpmdiakarveaafeffdkinapyfcfhdrdiapegdtlretnknldt
    ivamikdylktsktkvlwgtanlfsnprfvhgastscnadvfaysaaqvkkaleitkelg
    genyvfwggregyetllntdmefeldnfarflhmavdyakeigfegqfliepkpkeptkh
    qydfdvanvlaflrkydldkyfkvnieanhatlafhdfqhelryaringvlgsidantgd
    mllgwdtdqfptdirmttlamyevikmggfdkgglnfdakvrrasfepedlflghiagmd
    afakgfkvayklvkdrvfdkfieeryasykdgigadivsgkadfrslekyalersqivnk
    sgrqellesilnqylfa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1a0cD (D:)
    nkyfenvskikyegpksnnpysfkfynpeevidgktmeehlrfsiaywhtftadgtdqfg
    katmqrpwnhytdpmdiakarveaafeffdkinapyfcfhdrdiapegdtlretnknldt
    ivamikdylktsktkvlwgtanlfsnprfvhgastscnadvfaysaaqvkkaleitkelg
    genyvfwggregyetllntdmefeldnfarflhmavdyakeigfegqfliepkpkeptkh
    qydfdvanvlaflrkydldkyfkvnieanhatlafhdfqhelryaringvlgsidantgd
    mllgwdtdqfptdirmttlamyevikmggfdkgglnfdakvrrasfepedlflghiagmd
    afakgfkvayklvkdrvfdkfieeryasykdgigadivsgkadfrslekyalersqivnk
    sgrqellesilnqylfae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0cD (D:)
    nkyfenvskikyegpksnnpysfkfynpeevidgktmeehlrfsiaywhtftadgtdqfg
    katmqrpwnhytdpmdiakarveaafeffdkinapyfcfhdrdiapegdtlretnknldt
    ivamikdylktsktkvlwgtanlfsnprfvhgastscnadvfaysaaqvkkaleitkelg
    genyvfwggregyetllntdmefeldnfarflhmavdyakeigfegqfliepkpkeptkh
    qydfdvanvlaflrkydldkyfkvnieanhatlafhdfqhelryaringvlgsidantgd
    mllgwdtdqfptdirmttlamyevikmggfdkgglnfdakvrrasfepedlflghiagmd
    afakgfkvayklvkdrvfdkfieeryasykdgigadivsgkadfrslekyalersqivnk
    sgrqellesilnqylfa