PDB entry 1a0b

View 1a0b on RCSB PDB site
Description: histidine-containing phosphotransfer domain of arcb from escherichia coli
Class: histidine kinase
Keywords: histidine kinase, phosphotransfer, two-component system, four-helix bundle
Deposited on 1997-11-27, released 1998-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.181
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aerobic respiration control sensor protein arcb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a0ba_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1a0bA (A:)
tteensksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiv
eeghkikgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawva
katkk

    Sequence, based on observed residues (ATOM records): (download) 
    >1a0bA (A:)
ksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiveeghki
kgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawvakat