PDB entry 1a0b

View 1a0b on RCSB PDB site
Description: histidine-containing phosphotransfer domain of arcb from escherichia coli
Deposited on 1997-11-27, released 1998-03-18
The last revision prior to the SCOP 1.57 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.181
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1a0b__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a0b_ (-)
  ksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiveeghki
  kgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawvakat