PDB entry 1a0a

View 1a0a on RCSB PDB site
Description: phosphate system positive regulatory protein pho4/DNA complex
Class: transcription/DNA
Keywords: transcription factor, basic helix loop helix, complex (transcription factor/DNA), transcription/DNA complex
Deposited on 1997-11-27, released 1998-03-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.23
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phosphate system positive regulatory protein pho4)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07270 (0-62)
      • conflict (0)
      • conflict (19)
    Domains in SCOPe 2.03: d1a0aa_
  • Chain 'B':
    Compound: protein (phosphate system positive regulatory protein pho4)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07270 (0-62)
      • conflict (0)
      • conflict (19)
    Domains in SCOPe 2.03: d1a0ab_
  • Chain 'C':
    Compound: DNA (5'-d(*cp*tp*cp*ap*cp*ap*cp*gp*tp*gp*gp*gp*ap*cp*tp*ap*g )-3')
  • Chain 'D':
    Compound: DNA (5'-d(*cp*tp*ap*gp*tp*cp*cp*cp*ap*cp*gp*tp*gp*tp*gp*ap*g )-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0aA (A:)
    mkreshkhaeqarrnrlavalhelaslipaewkqqnvsaapskattveaacryirhlqqn
    gst
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0aB (B:)
    mkreshkhaeqarrnrlavalhelaslipaewkqqnvsaapskattveaacryirhlqqn
    gst
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.