PDB entry 1a0a

View 1a0a on RCSB PDB site
Description: phosphate system positive regulatory protein pho4/dna complex
Deposited on 1997-11-27, released 1998-03-18
The last revision prior to the SCOP 1.67 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.23
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1a0aa_
  • Chain 'B':
    Domains in SCOP 1.67: d1a0ab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a0aA (A:)
mkreshkhaeqarrnrlavalhelaslipaewkqqnvsaapskattveaacryirhlqqn
gst

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a0aB (B:)
mkreshkhaeqarrnrlavalhelaslipaewkqqnvsaapskattveaacryirhlqqn
gst