PDB entry 1a07

View 1a07 on RCSB PDB site
Description: c-src (sh2 domain) complexed with ace-malonyl tyr-glu-(n,n-dipentyl amine)
Deposited on 1997-12-09, released 1998-04-08
The last revision prior to the SCOP 1.59 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1a07a_
  • Chain 'B':
    Domains in SCOP 1.59: d1a07b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a07A (A:)
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a07B (B:)
    iqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhy
    kirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp