PDB entry 1a06

View 1a06 on RCSB PDB site
Description: calmodulin-dependent protein kinase from rat
Class: kinase
Keywords: kinase, signal transduction, calcium/calmodulin
Deposited on 1997-12-09, released 1998-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium/calmodulin-dependent protein kinase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1a06a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a06A (A:)
    mpgavegprwkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciakkalegke
    gsmeneiavlhkikhpnivalddiyesgghlylimqlvsggelfdrivekgfyterdasr
    lifqvldavkylhdlgivhrdlkpenllyysldedskimisdfglskmedpgsvlstacg
    tpgyvapevlaqkpyskavdcwsigviayillcgyppfydendaklfeqilkaeyefdsp
    ywddisdsakdfirhlmekdpekrftceqalqhpwiagdtaldknihqsvseqikknfak
    skwkqafnatavvrhmrklqlghqpggtgtds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a06A (A:)
    wkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciakeneiavlhkikhpniv
    alddiyesgghlylimqlvsggelfdrivekgfyterdasrlifqvldavkylhdlgivh
    rdlkpenllyysldedskimisdfpgyvapevlaqkpyskavdcwsigviayillcgypp
    fydendaklfeqilkaeyefdspywddisdsakdfirhlmekdpekrftceqalqhpwia
    gdtaldknihqsvseqikknfakskwkqafnatavvrhm