PDB entry 1a06

View 1a06 on RCSB PDB site
Description: calmodulin-dependent protein kinase from rat
Deposited on 1997-12-09, released 1998-04-08
The last revision prior to the SCOP 1.59 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1a06__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1a06_ (-)
    wkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciakkalegkegsmeneiav
    lhkikhpnivalddiyesgghlylimqlvsggelfdrivekgfyterdasrlifqvldav
    kylhdlgivhrdlkpenllyysldedskimisdfglskmedpgsvlstacgtpgyvapev
    laqkpyskavdcwsigviayillcgyppfydendaklfeqilkaeyefdspywddisdsa
    kdfirhlmekdpekrftceqalqhpwiagdtaldknihqsvseqikknfakskwkqafna
    tavvrhm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a06_ (-)
    wkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciakeneiavlhkikhpniv
    alddiyesgghlylimqlvsggelfdrivekgfyterdasrlifqvldavkylhdlgivh
    rdlkpenllyysldedskimisdfpgyvapevlaqkpyskavdcwsigviayillcgypp
    fydendaklfeqilkaeyefdspywddisdsakdfirhlmekdpekrftceqalqhpwia
    gdtaldknihqsvseqikknfakskwkqafnatavvrhm