PDB entry 1a05

View 1a05 on RCSB PDB site
Description: crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate
Deposited on 1997-12-09, released 1998-06-17
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1977
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a05a_
  • Chain 'B':
    Domains in SCOP 1.55: d1a05b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a05A (A:)
    mkkiaifagdgigpeivaaarqvldavdqaahlglrcteglvggaaldasddplpaaslq
    lamaadavilgavggprwdayppakrpeqgllrlrkgldlyanlrpaqifpqlldasplr
    pelvrdvdilvvreltgdiyfgqprglevidgkrrgfntmvydedeirriahvafraaqg
    rrkqlcsvdkanvlettrlwrevvtevardypdvrlshmyvdnaamqlirapaqfdvllt
    gnmfgdilsdeasqltgsigmlpsaslgegramyepihgsapdiagqdkanplatilsva
    mmlrhslnaepwaqrveaavqrvldqglrtadiaapgtpvigtkamgaavvnalnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a05B (B:)
    mkkiaifagdgigpeivaaarqvldavdqaahlglrcteglvggaaldasddplpaaslq
    lamaadavilgavggprwdayppakrpeqgllrlrkgldlyanlrpaqifpqlldasplr
    pelvrdvdilvvreltgdiyfgqprglevidgkrrgfntmvydedeirriahvafraaqg
    rrkqlcsvdkanvlettrlwrevvtevardypdvrlshmyvdnaamqlirapaqfdvllt
    gnmfgdilsdeasqltgsigmlpsaslgegramyepihgsapdiagqdkanplatilsva
    mmlrhslnaepwaqrveaavqrvldqglrtadiaapgtpvigtkamgaavvnalnlk