PDB entry 1a04

View 1a04 on RCSB PDB site
Description: the structure of the nitrate/nitrite response regulator protein narl in the monoclinic c2 crystal form
Class: signal transduction protein
Keywords: signal transduction protein, response regulators, two-component systems
Deposited on 1997-12-08, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrate/nitrite response regulator protein narl
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a04a1, d1a04a2
  • Chain 'B':
    Compound: nitrate/nitrite response regulator protein narl
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a04b1, d1a04b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a04A (A:)
    snqepatilliddhpmlrtgvkqlismapditvvgeasngeqgielaesldpdlilldln
    mpgmngletldklrekslsgrivvfsvsnheedvvtalkrgadgyllkdmepedllkalh
    qaaagemvlsealtpvlaaslranratterdvnqltprerdilkliaqglpnkmiarrld
    itestvkvhvkhmlkkmklksrveaavwvhqerif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a04A (A:)
    epatilliddhpmlrtgvkqlismapditvvgeasngeqgielaesldpdlilldlnmpg
    mngletldklrekslsgrivvfsvsnheedvvtalkrgadgyllkdmepedllkalhqaa
    agemvlsealtpvlaaslerdvnqltprerdilkliaqglpnkmiarrlditestvkvhv
    khmlkkmklksrveaavwvhqerif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a04B (B:)
    snqepatilliddhpmlrtgvkqlismapditvvgeasngeqgielaesldpdlilldln
    mpgmngletldklrekslsgrivvfsvsnheedvvtalkrgadgyllkdmepedllkalh
    qaaagemvlsealtpvlaaslranratterdvnqltprerdilkliaqglpnkmiarrld
    itestvkvhvkhmlkkmklksrveaavwvhqerif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a04B (B:)
    epatilliddhpmlrtgvkqlismapditvvgeasngeqgielaesldpdlilldlnmpg
    mngletldklrekslsgrivvfsvsnheedvvtalkrgadgyllkdmepedllkalhqaa
    agemvlsealtpvlaaslerdvnqltprerdilkliaqglpnkmiarrlditestvkvhv
    khmlkkmklksrveaavwvhqerif