PDB entry 1a02

View 1a02 on RCSB PDB site
Description: structure of the DNA binding domains of nfat, fos and jun bound to DNA
Class: transcription/DNA
Keywords: transcription factor, nfat, nf-at, ap-1, fos-jun, quaternary protein-DNA complex, transcription synergy, combinatorial gene regulation, transcription/DNA complex
Deposited on 1997-12-08, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.246
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*dtp*dtp*dgp*dgp*dap*dap*dap*dap*dtp*dtp*dtp*dgp*dtp*dtp*dtp*dcp*dap*dtp*dap*dg)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*dap*dap*dcp*dtp*dap*dtp*dgp*dap*dap*dap*dcp*dap*dap*dap*dtp*dtp*dtp*dtp*dcp*dc)-3')
  • Chain 'F':
    Compound: ap-1 fragment fos
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01100
      • engineered (16)
    Domains in SCOPe 2.07: d1a02f_
  • Chain 'J':
    Compound: ap-1 fragment jun
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05412 (Start-55)
      • engineered (16)
    Domains in SCOPe 2.07: d1a02j_
  • Chain 'N':
    Compound: nuclear factor of activated t cells
    Species: Homo sapiens [TaxId:9606]
    Gene: NFAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a02n1, d1a02n2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1a02F (F:)
    mkrrirrernkmaaaksrnrrreltdtlqaetdqledeksalqteianllkekekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a02F (F:)
    rrirrernkmaaaksrnrrreltdtlqaetdqledeksalqteianllkekek
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1a02J (J:)
    mkaerkrmrnriaasksrkrkleriarleekvktlkaqnselastanmlreqvaql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a02J (J:)
    rkrmrnriaasksrkrkleriarleekvktlkaqnselastanmlreqvaql
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1a02N (N:)
    mrgshhhhhhtdphassvplewplssqsgsyelrievqpkphhrahyetegsrgavkapt
    gghpvvqlhgymenkplglqifigtaderilkphafyqvhritgktvtttsyekivgntk
    vleiplepknnmratidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgri
    vslqtasnpiecsqrsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttd
    gqqiwemeatvdkdksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhp
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a02N (N:)
    wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
    figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
    lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsahelp
    mverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpnml
    fveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv