PDB entry 1YHY

View 1YHY on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana Acetohydroxyacid synthase In Complex With A Sulfonylurea Herbicide, Metsulfuron methyl
Class: Transferase
Keywords: Acetohydroxyacid synthase, acetolactate synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor, cysteine-s-dioxide, CHES, metsulfuron methyl, Transferase
Deposited on 2005-01-10, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.193
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ILVB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17597 (0-581)
      • modified residue (254)
    Domains in SCOPe 2.07: d1yhya1, d1yhya2, d1yhya3
  • Heterogens: MG, 1MM, NHE, FAD, P22, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yhyA (A:)
    tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
    ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
    fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
    nweqamrlpgymsrmpkppedshleqivrliseskkpvlyvgggclnssdelgrfveltg
    ipvastlmglgsypcddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleaf
    asrakivhididsaeigknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrneln
    vqkqkfplsfktfgeaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwl
    ssgglgamgfglpaaigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnn
    qhlgmvmqwedrfykanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreai
    qtmldtpgpylldvicphqehvlpmipsggtfndvitegdgrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yhyA (A:)
    tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
    ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
    fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
    nweqamrlpgymsrmpkppedshleqivrliseskkpvlyvgggclnssdelgrfveltg
    ipvastlmglgsypcddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleaf
    asrakivhididsaeigknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrneln
    vqkqkfplsfktfgeaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwl
    ssgglgamgfglpaaigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnn
    qhlgmvmqwedrfykanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreai
    qtmldtpgpylldvicphqehvlpmipsggtfndvitegdgr