SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 1RZG

View 1RZG on RCSB PDB site
Description: Crystal structure of Human anti-HIV-1 GP120 reactive antibody 412d
Class: immune system
Keywords: HIV-1; gp120; CD4i; antibodies; tyrosine sulfation; VH-gene usage, IMMUNE SYSTEM
Deposited on 2003-12-24, released 2004-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab 412d light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZG (0-230)
    Domains in SCOPe 2.06: d1rzga1, d1rzga2
  • Chain 'B':
    Compound: Fab 412d heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZG (0-End)
    Domains in SCOPe 2.06: d1rzgb1, d1rzgb2
  • Chain 'C':
    Compound: Fab 412d light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZG
    Domains in SCOPe 2.06: d1rzgc1, d1rzgc2
  • Chain 'D':
    Compound: Fab 412d heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZG (0-213)
    Domains in SCOPe 2.06: d1rzgd1, d1rzgd2
  • Heterogens: SUC, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rzgA (A:)
    evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
    aqrfqgrvsitadeststaymelsslrsedtavfycaspypndyndyapeegmswyfdlw
    grgtlvtvspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgv
    htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzgA (A:)
    evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
    aqrfqgrvsitadeststaymelsslrsedtavfycaspypndygmswyfdlwgrgtlvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rzgB (B:)
    diqmtqspstlsasvgdrvtitcrasqsisnwlawyqqkpgrapkllmykasslksgvps
    rfsgsgsgteftltisslqsddfatyycqqhdsspytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhklyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzgB (B:)
    diqmtqspstlsasvgdrvtitcrasqsisnwlawyqqkpgrapkllmykasslksgvps
    rfsgsgsgteftltisslqsddfatyycqqhdsspytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhklyacevthqglsspvtksfnrge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rzgC (C:)
    evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
    aqrfqgrvsitadeststaymelsslrsedtavfycaspypndyndyapeegmswyfdlw
    grgtlvtvspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgv
    htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzgC (C:)
    vqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahya
    qrfqgrvsitadeststaymelsslrsedtavfycaspypndygmswyfdlwgrgtlvtv
    spastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzgD (D:)
    diqmtqspstlsasvgdrvtitcrasqsisnwlawyqqkpgrapkllmykasslksgvps
    rfsgsgsgteftltisslqsddfatyycqqhdsspytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhklyacevthqglsspvtksfnrgec