You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 1RZG

View 1RZG on RCSB PDB site
Description: Crystal structure of Human anti-HIV-1 GP120 reactive antibody 412d
Class: immune system
Keywords: HIV-1; gp120; CD4i; antibodies; tyrosine sulfation; VH-gene usage, IMMUNE SYSTEM
Deposited on 2003-12-24, released 2004-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab 412d light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZG (0-230)
    Domains in SCOPe 2.06: d1rzga1, d1rzga2
  • Chain 'B':
    Compound: Fab 412d heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZG (0-End)
    Domains in SCOPe 2.06: d1rzgb1, d1rzgb2
  • Chain 'C':
    Compound: Fab 412d light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZG
    Domains in SCOPe 2.06: d1rzgc1, d1rzgc2
  • Chain 'D':
    Compound: Fab 412d heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZG (0-213)
    Domains in SCOPe 2.06: d1rzgd1, d1rzgd2
  • Heterogens: SUC, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rzgA (A:)
    evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
    aqrfqgrvsitadeststaymelsslrsedtavfycaspypndyndyapeegmswyfdlw
    grgtlvtvspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgv
    htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzgA (A:)
    evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
    aqrfqgrvsitadeststaymelsslrsedtavfycaspypndygmswyfdlwgrgtlvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rzgB (B:)
    diqmtqspstlsasvgdrvtitcrasqsisnwlawyqqkpgrapkllmykasslksgvps
    rfsgsgsgteftltisslqsddfatyycqqhdsspytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhklyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzgB (B:)
    diqmtqspstlsasvgdrvtitcrasqsisnwlawyqqkpgrapkllmykasslksgvps
    rfsgsgsgteftltisslqsddfatyycqqhdsspytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhklyacevthqglsspvtksfnrge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rzgC (C:)
    evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
    aqrfqgrvsitadeststaymelsslrsedtavfycaspypndyndyapeegmswyfdlw
    grgtlvtvspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgv
    htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzgC (C:)
    vqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahya
    qrfqgrvsitadeststaymelsslrsedtavfycaspypndygmswyfdlwgrgtlvtv
    spastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzgD (D:)
    diqmtqspstlsasvgdrvtitcrasqsisnwlawyqqkpgrapkllmykasslksgvps
    rfsgsgsgteftltisslqsddfatyycqqhdsspytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhklyacevthqglsspvtksfnrgec