You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 1RZ7

View 1RZ7 on RCSB PDB site
Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 48d
Class: immune system
Keywords: HIV-1; gp120; CD4i; antibodies; tyrosine sulfation; VH-gene usage, IMMUNE SYSTEM
Deposited on 2003-12-24, released 2004-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 48d heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZ7 (0-218)
    Domains in SCOPe 2.06: d1rz7h1, d1rz7h2
  • Chain 'L':
    Compound: Fab 48d light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZ7 (Start-211)
    Domains in SCOPe 2.06: d1rz7l1, d1rz7l2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rz7H (H:)
    evqlvqsgaevkkpgatvkisckasgytfsdfymywvrqapgkglewmglidpedadtmy
    aekfrgrvtitadtstdtgylelsslrsedtavyycaadpwelnafnvwgqgtlvsvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rz7L (L:)
    diqmtqspssvsasvgdrvtitcrasqdistwlawyqqkpgkapklliyaastlqsgvps
    rfsgsgsgtdfsltinslqpedfatyycqqansfftfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhklyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz7L (L:)
    iqmtqspssvsasvgdrvtitcrasqdistwlawyqqkpgkapklliyaastlqsgvpsr
    fsgsgsgtdfsltinslqpedfatyycqqansfftfgggtkveikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhklyacevthqglsspvtksfnrge