SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 1RA6

View 1RA6 on RCSB PDB site
Description: Poliovirus Polymerase Full Length Apo Structure
Class: transferase
Keywords: NUCLEOTIDYLTRANSFERASE, POLIOVIRUS, 3D, RNA-DEPENDENT, POLYMERASE, N-TERMINUS, transferase
Deposited on 2003-10-31, released 2004-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Human poliovirus 1 [TaxId:12081]
    Gene: 3D
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03300 (0-460)
      • modified residue (95)
      • modified residue (211)
      • modified residue (280)
      • modified residue (289)
      • engineered (445)
      • engineered (454)
    Domains in SCOPe 2.06: d1ra6a_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ra6A (A:)
    geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
    kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
    vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
    lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
    lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
    nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
    atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
    awhngeeeynkflakirsvpigraldlpeystlydrwldsf