You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 1RA6

View 1RA6 on RCSB PDB site
Description: Poliovirus Polymerase Full Length Apo Structure
Class: transferase
Keywords: NUCLEOTIDYLTRANSFERASE, POLIOVIRUS, 3D, RNA-DEPENDENT, POLYMERASE, N-TERMINUS, transferase
Deposited on 2003-10-31, released 2004-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Human poliovirus 1 [TaxId:12081]
    Gene: 3D
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03300 (0-460)
      • modified residue (95)
      • modified residue (211)
      • modified residue (280)
      • modified residue (289)
      • engineered (445)
      • engineered (454)
    Domains in SCOPe 2.06: d1ra6a_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ra6A (A:)
    geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
    kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
    vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
    lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
    lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
    nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
    atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
    awhngeeeynkflakirsvpigraldlpeystlydrwldsf