SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 1DKU

View 1DKU on RCSB PDB site
Description: crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation.
Class: transferase
Keywords: open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold
Deposited on 1999-12-08, released 2000-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phosphoribosyl pyrophosphate synthetase)
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dkua1, d1dkua2
  • Chain 'B':
    Compound: protein (phosphoribosyl pyrophosphate synthetase)
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dkub1, d1dkub2
  • Heterogens: AP2, ABM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dkuA (A:)
    msnqygdknlkifslnsnpelakeiadivgvqlgkcsvtrfsdgevqinieesirgcdcy
    iiqstsdpvnehimellimvdalkrasaktinivipyygyarqdrkarsrepitaklfan
    lletagatrvialdlhapqiqgffdipidhlmgvpilgeyfegknledivivspdhggvt
    rarkladrlkapiaiidkrrprpnvaevmnivgniegktailiddiidtagtitlaanal
    vengakevyaccthpvlsgpaverinnstikelvvtnsiklpeekkierfkqlsvgplla
    eaiirvheqqsvsylfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkuA (A:)
    nlkifslnsnpelakeiadivgvqlgkcsvtrfsdgevqinieesirgcdcyiiqstsdp
    vnehimellimvdalkrasaktinivipyygyarqdrkarsrepitaklfanlletagat
    rvialdlhapqiqgffdipidhlmgvpilgeyfegknledivivspdhggvtrarkladr
    lkapiaiidkrmnivgniegktailiddiidtagtitlaanalvengakevyaccthpvl
    sgpaverinnstikelvvtnsiklkierfkqlsvgpllaeaiirvheqqsvsylf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dkuB (B:)
    msnqygdknlkifslnsnpelakeiadivgvqlgkcsvtrfsdgevqinieesirgcdcy
    iiqstsdpvnehimellimvdalkrasaktinivipyygyarqdrkarsrepitaklfan
    lletagatrvialdlhapqiqgffdipidhlmgvpilgeyfegknledivivspdhggvt
    rarkladrlkapiaiidkrrprpnvaevmnivgniegktailiddiidtagtitlaanal
    vengakevyaccthpvlsgpaverinnstikelvvtnsiklpeekkierfkqlsvgplla
    eaiirvheqqsvsylfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkuB (B:)
    nlkifslnsnpelakeiadivgvqlgkcsvtrfsdgevqinieesirgcdcyiiqstsdp
    vnehimellimvdalkrasaktinivipyygyarqdrkarsrepitaklfanlletagat
    rvialdlhapqiqgffdipidhlmgvpilgeyfegknledivivspdhggvtrarkladr
    lkapiaiidkrmnivgniegktailiddiidtagtitlaanalvengakevyaccthpvl
    sgpaverinnstikelvvtnsiklkierfkqlsvgpllaeaiirvheqqsvsylf