You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 1DKU

View 1DKU on RCSB PDB site
Description: crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation.
Class: transferase
Keywords: open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold
Deposited on 1999-12-08, released 2000-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phosphoribosyl pyrophosphate synthetase)
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dkua1, d1dkua2
  • Chain 'B':
    Compound: protein (phosphoribosyl pyrophosphate synthetase)
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dkub1, d1dkub2
  • Heterogens: AP2, ABM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dkuA (A:)
    msnqygdknlkifslnsnpelakeiadivgvqlgkcsvtrfsdgevqinieesirgcdcy
    iiqstsdpvnehimellimvdalkrasaktinivipyygyarqdrkarsrepitaklfan
    lletagatrvialdlhapqiqgffdipidhlmgvpilgeyfegknledivivspdhggvt
    rarkladrlkapiaiidkrrprpnvaevmnivgniegktailiddiidtagtitlaanal
    vengakevyaccthpvlsgpaverinnstikelvvtnsiklpeekkierfkqlsvgplla
    eaiirvheqqsvsylfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkuA (A:)
    nlkifslnsnpelakeiadivgvqlgkcsvtrfsdgevqinieesirgcdcyiiqstsdp
    vnehimellimvdalkrasaktinivipyygyarqdrkarsrepitaklfanlletagat
    rvialdlhapqiqgffdipidhlmgvpilgeyfegknledivivspdhggvtrarkladr
    lkapiaiidkrmnivgniegktailiddiidtagtitlaanalvengakevyaccthpvl
    sgpaverinnstikelvvtnsiklkierfkqlsvgpllaeaiirvheqqsvsylf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dkuB (B:)
    msnqygdknlkifslnsnpelakeiadivgvqlgkcsvtrfsdgevqinieesirgcdcy
    iiqstsdpvnehimellimvdalkrasaktinivipyygyarqdrkarsrepitaklfan
    lletagatrvialdlhapqiqgffdipidhlmgvpilgeyfegknledivivspdhggvt
    rarkladrlkapiaiidkrrprpnvaevmnivgniegktailiddiidtagtitlaanal
    vengakevyaccthpvlsgpaverinnstikelvvtnsiklpeekkierfkqlsvgplla
    eaiirvheqqsvsylfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkuB (B:)
    nlkifslnsnpelakeiadivgvqlgkcsvtrfsdgevqinieesirgcdcyiiqstsdp
    vnehimellimvdalkrasaktinivipyygyarqdrkarsrepitaklfanlletagat
    rvialdlhapqiqgffdipidhlmgvpilgeyfegknledivivspdhggvtrarkladr
    lkapiaiidkrmnivgniegktailiddiidtagtitlaanalvengakevyaccthpvl
    sgpaverinnstikelvvtnsiklkierfkqlsvgpllaeaiirvheqqsvsylf