PDB entry 19hc

View 19hc on RCSB PDB site
Description: nine-haem cytochrome c from desulfovibrio desulfuricans atcc 27774
Class: electron transport
Keywords: electron transfer, cytochrome, electron transport
Deposited on 1998-11-27, released 1999-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (nine-haem cytochrome c)
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d19hca_
  • Chain 'B':
    Compound: protein (nine-haem cytochrome c)
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d19hcb_
  • Heterogens: ACT, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >19hcA (A:)
    aaleptdsgapsaivmfpvgekpnpkgaamkpvvfnhlihekkiadcetchhtgdpvscs
    tchtvegkaegdyitldramhatdiaarakgntptscvschqsetkerrecagchaittp
    kddeawcatchditpsmtpsemqkgiagtllpgdnealaaetvlaeatvapvspmlapyk
    vvidaladkyepsdfthrrhltslmesikddklaqafhdkpeilcatchhrsplsltppk
    cgschtkeidaadpgrpnlmaayhlecmgchkgmavarprdtdcttchkaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >19hcB (B:)
    aaleptdsgapsaivmfpvgekpnpkgaamkpvvfnhlihekkiadcetchhtgdpvscs
    tchtvegkaegdyitldramhatdiaarakgntptscvschqsetkerrecagchaittp
    kddeawcatchditpsmtpsemqkgiagtllpgdnealaaetvlaeatvapvspmlapyk
    vvidaladkyepsdfthrrhltslmesikddklaqafhdkpeilcatchhrsplsltppk
    cgschtkeidaadpgrpnlmaayhlecmgchkgmavarprdtdcttchkaaa